PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN02846.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 441aa    MW: 49237.1 Da    PI: 6.959
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN02846.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding568.9e-1853100148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WTt Ed +l d+v+++G g+W+++ r  g++R++k+c++rw ++l
       KHN02846.1  53 KGPWTTAEDAILTDYVTKHGEGNWNAVQRNTGLNRCGKSCRLRWANHL 100
                      79******************************************9986 PP

2Myb_DNA-binding52.31.3e-16106149146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++++vd++ q+G++ W++ a+ ++ gRt++++k++w++
       KHN02846.1 106 KGAFSPEEEKIIVDLHSQFGNK-WARMAALLP-GRTDNEIKNYWNT 149
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.94248100IPR017930Myb domain
SuperFamilySSF466896.74E-3051147IPR009057Homeodomain-like
SMARTSM007176.8E-1452102IPR001005SANT/Myb domain
PfamPF002491.6E-1453100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2354107IPR009057Homeodomain-like
CDDcd001672.36E-1055100No hitNo description
PROSITE profilePS5129424.27101155IPR017930Myb domain
SMARTSM007172.6E-15105153IPR001005SANT/Myb domain
PfamPF002491.4E-14106149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-25108154IPR009057Homeodomain-like
CDDcd001673.04E-11108149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MEGMANICDD ATEGDNAFLT MFGGDESGGS GGSDGRSGGD QGGGNVEDVA LKKGPWTTAE  60
DAILTDYVTK HGEGNWNAVQ RNTGLNRCGK SCRLRWANHL RPNLKKGAFS PEEEKIIVDL  120
HSQFGNKWAR MAALLPGRTD NEIKNYWNTR IKRRQRQGLP LYSDEHDHNH RSTTPTSPTT  180
PSPCLTPTGS NPNIATSFEF FNQNQQQQQQ YQHQYQYQQQ QHPLSPTASH HSPLSSPLQH  240
RQPFTSSSPH NFLDHSPLPL SSSSPSPLSF SFQKPAPMLS TPLRFKRYRT SPSYNNHLSD  300
PPLTTQFPHL DGFRFPVSSG FSQFFQPSLL DSDRGVSSSS SLAFQPKLEL PSSQYYKPPH  360
EQDIKLDIEF NDPSFQSSSS GFLGDLLFEA QAMASGQNSK KRGYLSLNER NDVFDACQSF  420
ENFPSSSLYW PSSTSGWFLD R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30511545107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150382e-91AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014625862.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0B2P0F70.0A0A0B2P0F7_GLYSO; Transcription factor GAMYB
STRINGGLYMA18G10921.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.18e-68myb domain protein 101
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]